PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_222000_heoc.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 238aa    MW: 27414.6 Da    PI: 10.4887
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_222000_heoc.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.61.2e-261059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        ri+n++ rqvtfskRr+g++KKA ELS+LCda   +iifsstgklyey+s
  Bv9_222000_heoc.t1 10 RIDNTTSRQVTFSKRRTGLIKKARELSILCDAHLGLIIFSSTGKLYEYAS 59
                        9***********************************************86 PP

2K-box86.45.8e-2980169998
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                         + +++ e +q+e+a+L+++++ L++++R+l+GedL+ Ls+k+Lq+Le+qL  slk +R +K++++ e+i+e+++k + +++en +L++kl
  Bv9_222000_heoc.t1  80 TLAQDLEFWQREVARLRQQLQLLKENHRKLMGEDLSGLSIKDLQNLENQLGASLKGVRMQKDQHIAEEIKEQKRKGNLIRQENVELHHKL 169
                         567889**********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.9E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.431161IPR002100Transcription factor, MADS-box
CDDcd002652.60E-40272No hitNo description
SuperFamilySSF554551.57E-30290IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-2584169IPR002487Transcription factor, K-box
PROSITE profilePS5129715.04985175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGRGKMVIQR IDNTTSRQVT FSKRRTGLIK KARELSILCD AHLGLIIFSS TGKLYEYAST  60
NMGSVIERYN KTRDNNQPPT LAQDLEFWQR EVARLRQQLQ LLKENHRKLM GEDLSGLSIK  120
DLQNLENQLG ASLKGVRMQK DQHIAEEIKE QKRKGNLIRQ ENVELHHKLN LAKQENLDLK  180
TKLNGAYKVT QAYQHTNMSS NVVRSEYLIK PMYLQLSQPQ SLNIDASART MKLGLQLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-20278174MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-20278174MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-20278174MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-20278174MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P2e-20190190Myocyte-specific enhancer factor 2B
1tqe_Q2e-20190190Myocyte-specific enhancer factor 2B
1tqe_R2e-20190190Myocyte-specific enhancer factor 2B
1tqe_S2e-20190190Myocyte-specific enhancer factor 2B
3kov_A3e-20278174Myocyte-specific enhancer factor 2A
3kov_B3e-20278174Myocyte-specific enhancer factor 2A
3kov_I3e-20278174Myocyte-specific enhancer factor 2A
3kov_J3e-20278174Myocyte-specific enhancer factor 2A
3p57_A3e-20278174Myocyte-specific enhancer factor 2A
3p57_B3e-20278174Myocyte-specific enhancer factor 2A
3p57_C3e-20278174Myocyte-specific enhancer factor 2A
3p57_D3e-20278174Myocyte-specific enhancer factor 2A
3p57_I3e-20278174Myocyte-specific enhancer factor 2A
3p57_J3e-20278174Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691451.11e-175PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6EP492e-80MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0J8BIW51e-175A0A0J8BIW5_BETVU; Uncharacterized protein
STRINGGLYMA14G36221.14e-90(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.12e-80AGAMOUS-like 16